DPCstruct | MC4414
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 162 ± 16 aa |
| Standard deviation of domain lengths | 16.36 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 38.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183V7Y1 | 1-146 | MPLPPVLLARLKRRGIIQEDANEEVIAESYDAEAAALPQKAPRNASDKNLAGAPACPNKYNPYHYCVQFCYDHWKEGTSESSLPKKY… |
| A0A183J6Z8 | 1-139 | MPLPPLLLARLKRRGIIKEGDAEEVIAENYDDENPEGAKRKSGSSASGCPNKWCPFHLCTDYCFDHWGDGVEEHRVDPVYNRKRLRM… |
| A0A182W1R1 | 146-331 | None |
| A0A131ZT98 | 2-152 | None |
| A0A7R9QDL0 | 1-165 | None |
| A0A182FUX9 | 221-404 | None |
| A0A3Q0KIW0 | 1-166 | None |
| A0A183HEB8 | 1-177 | None |
| A0A7R9GCK4 | 439-586 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.