DPCstruct | MC44138
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 86 ± 11 aa |
| Standard deviation of domain lengths | 11.42 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 34.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K1TQY4 | 1-62 | MNARGETYGVPNDDGIPDLVAAQASNGEIGYTRNSEQSAFEGEGYIKVYESDGETVIGWFPI |
| E8NFE0 | 221-305 | LAVNDRGQTYGSSGAGEEPDLIAVVATNGREGYVDADELADATGSSQKVASPDEALRWQGERAGQAFVVPVHLSDGVTRVGDFVV |
| A0A644ZXE0 | 184-283 | None |
| A0A6N7Y3B2 | 147-235 | None |
| A0A235FJ66 | 25-101 | None |
| A0A853CTW6 | 72-179 | None |
| A0A8A5Z1G6 | 143-223 | None |
| A0A1D9FLL8 | 67-154 | None |
| A0A1C2XYC6 | 34-127 | None |
| A0A7W7BQ87 | 140-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.