DPCstruct | MC44135
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1283 |
|---|---|
| Mean domain length (aa) | 217 ± 43 aa |
| Standard deviation of domain lengths | 42.96 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 74.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 13.82 |
| Pfam Score | 86.77 |
| Assigned Pfam label(s) | PF20150- CL0505- CL0020- CL0271- PF09803 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A178ELL1 | 10-214 | GDTSSESDTLSQSKSEIQQCSPLLDLPAEIRNMIYKYVLGNWTICAFSRTHRPAQYVIVDPFYTWHRNPPTNKLNVLSTCRQIYTEA… |
| A0A139HIV9 | 1-177 | MAGDRKTTSCLLSLPPEIQLIIWEFTVTSTDPLLINCACDSSYGGWTEEYYADRELWEKGERHPPWQPGLTRACASIRADALKMFYK… |
| A0A2H3GKR1 | 3-203 | None |
| A0A2H3G898 | 2-192 | None |
| A0A4Z0YM01 | 20-245 | None |
| A0A4Z0YBJ7 | 29-225 | None |
| A0A1V6SE41 | 1-176 | None |
| A0A6A5VBN5 | 20-230 | None |
| A0A6A5V9P2 | 1-161 | None |
| A0A6A5V1V5 | 18-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.