DPCstruct | MC44132
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 298 ± 42 aa |
| Standard deviation of domain lengths | 42.41 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 28.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A163HV35 | 6-295 | GSVDNLLSKLRCSGNGVAVRKRHHKRSTFFYAYECTEYAYCSTTSRRSNVESRPCISCKVTTCDECRIHCVYQSIYEAPSDPNDLPN… |
| A0A178EFN9 | 27-338 | KPKALLVECLQQYGLLRSIVSSLLPEDLLALALSSKAIHSAIVPRPCSLTNLLGKLESVDRHVETKPCIRCKVTTCDECRIHCLYQS… |
| A0A6A5SFA1 | 21-251 | None |
| A0A6A7A8T9 | 40-355 | None |
| A0A6A5V567 | 62-414 | None |
| A0A6A5KSU4 | 32-229 | None |
| A0A364NA64 | 146-455 | None |
| A0A6A6JM94 | 47-365 | None |
| A0A7C8I2K3 | 1-311 | None |
| A0A1Y2LNF0 | 58-399 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.