DPCstruct | MC4413
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 130 ± 11 aa |
| Standard deviation of domain lengths | 11.03 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E4RNT5 | 109-234 | FIRLILAMWFALLSHSELSCYIIIFLHQIYTPTVLTIPLPLMVFCWGTLTVPRPSKTFWVTIIAYTEVVVVVIKCIFQFEFLYWNKK… |
| A0A4Y2IWL4 | 265-391 | FMRFLVALYYAAISRSELLCYIVIVVNQMKAASILSLPLPLLVFLWGTLSVPRPTKAFWITIITYTEAIVVLKYLFQFYFFPWNNSP… |
| A0A067RJC4 | 39-153 | None |
| A7RMM3 | 233-355 | None |
| A0A151PJG2 | 282-425 | None |
| A0A060X2S1 | 648-782 | None |
| A0A0B2VML1 | 168-289 | None |
| A0A7R9B0Y0 | 67-199 | None |
| E7FD74 | 1615-1736 | None |
| A0A0C2CLK3 | 387-531 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.