DPCstruct | MC44123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 138 ± 20 aa |
| Standard deviation of domain lengths | 20.26 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I1E8T4 | 431-551 | GCTANKKALQFYKLENIANIRKIYISGCDSKIKKYVDVIIKNAEDALTRSPYSVIDKTTFPPSGDKQDYWHPAPYWWPDPSKKNGLP… |
| A0A7G7G379 | 2-130 | ENKFKINAGNEQCLAALKQLIAATAPSLSKTPTTIVNKSFTPPSGDKHDYTSLATYWWPNPKTASKLPYIRKDGQTNPEANAIKDNA… |
| A0A536IR28 | 19-153 | None |
| A0A5C6D573 | 211-350 | None |
| A0A2Z6RDP3 | 20-171 | None |
| A0A090WU28 | 26-174 | None |
| A0A146I6G6 | 121-304 | None |
| A0A3L7PES9 | 186-306 | None |
| A0A426CZ97 | 1-158 | None |
| A0A0F9K6T7 | 8-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.