DPCstruct | MC44122
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 141 ± 15 aa |
| Standard deviation of domain lengths | 15.16 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 27.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B0LV38 | 4-133 | VSLQADRLMLALVAIASILAFPIGWHYSNMDIATWAAPLLIAVAAGLYACCAGTAVTRYALPLILCAAVALQIQVSLSTLEFHFGVF… |
| A0A1I1E3Z0 | 7-173 | KNTEAFSMHGLHSSGDYLMVWVQWLLFLIALSLASWYGTWTEALIIGLPAALVPSVLTWMLPGNRITRVSQGLAFMVWAALHIHQAH… |
| B0C2K3 | 2-130 | None |
| A0A098LCZ8 | 8-132 | None |
| I4AND7 | 20-144 | None |
| A0A1I4PFD1 | 2-143 | None |
| A0A6L9PUB6 | 1-160 | None |
| A0A6N6ZFF5 | 18-152 | None |
| B3PIZ9 | 60-206 | None |
| A0A377PIY9 | 25-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.