DPCstruct | MC44120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 259 ± 21 aa |
| Standard deviation of domain lengths | 21.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A102EEU4 | 5-282 | KLEIIAAESADVARRVAAGDATHDIAGELGLRDPEVLEYVEILVACNGPASTAVRDGTPCGDVAQQYQIKSQDARLALEWEAIPGHA… |
| A0A6P2UUH9 | 3-285 | RLQELAIQGLAGERVRKGESYIKVAEEHGIPADSPGMYELTVIAIKEGPAGERVRRGESCIKVAEEHGIPADSYAMLRLQRLAIQEG… |
| A0A439IHF8 | 206-442 | None |
| A0A2L1D6Q0 | 2-287 | None |
| Q2NVR9 | 8-229 | None |
| A0A2L1D6N4 | 1-274 | None |
| A0A0D5IY81 | 119-363 | None |
| A0A4R1NB75 | 64-314 | None |
| A0A554TWN4 | 751-991 | None |
| K8W7Z8 | 85-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.