DPCstruct | MC4412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 274 ± 41 aa |
| Standard deviation of domain lengths | 41.27 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183V739 | 24-280 | RLLGRATVDVDFQKLENGFALVLSRMGNLHEREAHDQLLQVVADQKMYEVVIGGLLYGVLSDPLNASKYYKAMTLVANGSWFCALCN… |
| A0A6P6X7X0 | 2-282 | ARVHIKHLHAIVTDGYTYFISMLIKIVNELYAKLVDSVKTQLIWVTREMVNVLGVGFDGLLVALLRQIVGGDFSEGNLWLCFEMISL… |
| A0A2G5B1B4 | 1-272 | None |
| A0A1I8IJH0 | 18-238 | None |
| A0A4Y7JBC8 | 3-220 | None |
| A0A445IPY2 | 115-351 | None |
| A0A1I8F404 | 2-238 | None |
| A0A4S8IG44 | 186-512 | None |
| A0A3F2S1Q9 | 2-265 | None |
| A0A1I7YXW2 | 1-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.