DPCstruct | MC44116
Metacluster Properties and Pfam Annotations
| Number of structural domains | 297 |
|---|---|
| Mean domain length (aa) | 376 ± 85 aa |
| Standard deviation of domain lengths | 85.46 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 78.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 11.81 |
| Pfam Score | 23.87 |
| Assigned Pfam label(s) | PF04860- PF06381- PF12236- PF06074- PF13264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P6XFV9 | 14-382 | ARRIVELTTQYVVGGGLAVSAKDAAAQQFLKAFWRSRLNRMETRCMEWCDELARSGNLFVLLSTDAAGMSYARAVPAASIQRIETRS… |
| A0A379FHT7 | 59-346 | AVFYPITGNTRNGMIGMAFKKDPLVAVVEKLSCLKDDADGAGSSIYQLAQSSLESVLEVGRHGLYVDYNSDSKLPYIFQYRAEDIIN… |
| A0A1G3YGW0 | 43-441 | None |
| A0A7X7VHG3 | 7-485 | None |
| A0A2P8EL50 | 26-517 | None |
| A0A356FYW8 | 88-523 | None |
| A0A2T2RLK0 | 52-442 | None |
| A0A497NLK4 | 44-609 | None |
| A0A2U8G2R7 | 476-1161 | None |
| A0A7W1C4U2 | 2-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.