DPCstruct | MC44115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 364 ± 39 aa |
| Standard deviation of domain lengths | 38.87 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 15.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J4JLM7 | 1-403 | MKATDTSGLTGFGTFTIRVGSSVGAVGSIISQRFIDFRSFQRSLPTLAFERNLILEALGMDEQTFSNSLISLNESYKRALFLPQAER… |
| A0A843JWJ8 | 132-487 | LEISSRGKDIENALAIKYSDLNISKHEISKYDIPTQKILNEYFKINQIEERLWSIKEGYTEASPSEYENLFGNITEIRIPKRISKTA… |
| A0A7J4QB52 | 227-606 | None |
| A0A7J4M6Z5 | 1-358 | None |
| A0A2G9MKA3 | 231-625 | None |
| A0A842NWP5 | 546-845 | None |
| A0A842UUT9 | 653-1059 | None |
| A0A5E4JA54 | 644-979 | None |
| A0A0B3AW74 | 381-782 | None |
| A0A7C4BMV8 | 166-465 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.