DPCstruct | MC44111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 70 ± 9 aa |
| Standard deviation of domain lengths | 8.50 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 35.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6NXW4 | 13-85 | SQQRVECTKDSECAIGGCSSQVCTSIDKAKDLITTCEYREEYGCLKLTLCGCVDNKCQWNENEDYKTCLEEVR |
| A0A150U1J5 | 1-57 | MVTGCSGQVCADEDVATDCQWLEEYACYDKHGVCERGASGECGWRATPELEACVGAA |
| N0BN99 | 147-209 | None |
| A0A2D6G710 | 18-86 | None |
| K2B148 | 26-101 | None |
| A0A2D6PIF7 | 48-115 | None |
| A0A2M8BR21 | 315-411 | None |
| A0A7X9D6S8 | 124-190 | None |
| A0A419FS83 | 12-100 | None |
| A0A842V442 | 44-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.