DPCstruct | MC44108
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 165 ± 16 aa |
| Standard deviation of domain lengths | 16.10 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 43.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023- PF12037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6Q8E2 | 1-201 | MNTSVFFEVTQLSTNGKLHAYMLRLSPTISGGGASDDASLSLHRALTLQHALFHKLMVLNIPREGARVMWGYVNRILGQPSLIRESS… |
| A0A419PJ28 | 409-576 | AGSVLGTGFNAFISEREKVATVVGSLTLLAGGIYGAKYGVGTIARLVESRIGKPSLVRDTSRLNIVDAVRHPILTSKRMFSRPSDPL… |
| A0A1D6Q7N2 | 86-242 | None |
| A0A540LWB3 | 265-408 | None |
| A0A822YQS8 | 166-310 | None |
| A0A813B7M6 | 198-350 | None |
| A0A2A2LES6 | 74-244 | None |
| A0A7R8ZL84 | 508-680 | None |
| A0A0L7LNI0 | 146-321 | None |
| A0A150FU91 | 7-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.