DPCstruct | MC44106
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Standard deviation of domain lengths | 6.89 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 55.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6PP00 | 96-177 | AKPTLFKRPRLRMMEQNWNQYFKFWFYDEQTAEAVILLKQEDKWRVIRMLDPVWIVNCSKDDIDLLNMAEIYADDGHHDVGI |
| A0A5N6PYT6 | 1-75 | MKPKVFKRPRLRKVEQDWNPFFKFWFYDDRTSEGVIVLKQDDNWRVIRMLDPIWIVNCSKDDVDLLNTAEIYAEE |
| A0A5N6Q034 | 62-137 | None |
| A0A5N6P8D2 | 258-336 | None |
| A0A5N6PV77 | 207-286 | None |
| A0A5N6MK32 | 995-1071 | None |
| A0A5N6LNA5 | 333-417 | None |
| A0A5N6L7L0 | 52-136 | None |
| A0A5N6MJ84 | 1-62 | None |
| A0A5N6M8J1 | 118-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.