DPCstruct | MC44102
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 75 ± 3 aa |
| Standard deviation of domain lengths | 3.02 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 94.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 63.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453Q704 | 303-379 | GHENASAENGPWMITLDAPSFMAVMQHAKNRALREEVYRAYLTRASSGDLDNTDIISQILKLRLEKAKLLGYKNFAE |
| A0A5D2LLA2 | 1-71 | MITLDAPSFIFVMQHARNCAFHEEVYRAYITQASNGDLDNTPIINQILKLRLKKAKLLNYNNYAEVYHRLC |
| A0A2X1MVJ3 | 1-69 | None |
| A0A401PU67 | 7-83 | None |
| A0A0D2ZU89 | 20-95 | None |
| A0A453Q743 | 250-326 | None |
| A0A540ME95 | 310-386 | None |
| A0A0A0L0F6 | 307-383 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.