DPCstruct | MC44101
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 86 ± 8 aa |
| Standard deviation of domain lengths | 7.59 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 51.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813M9L6 | 2-76 | SCILAKQLCVRPDADNHWALRDYASSRCAQMVKMFSASIHGLRNRIVRIFLRTFHSERLPLVTHYGALVGLCEMG |
| A0A5D2L7D9 | 1-83 | MPSIITCLVAKRLGNKFTDNHWELRNFAAKLVASICKRFGHVYHNLQPRVTRTLLHAFLDPTKTFPQHYGAIQGLAALGPSVV |
| A0A5A7PJQ4 | 421-514 | None |
| A0A674H938 | 2-98 | None |
| A0A5J5NFU6 | 1-82 | None |
| A0A401RGB2 | 68-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.