DPCstruct | MC441
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 187 ± 28 aa |
| Standard deviation of domain lengths | 27.85 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4XS81 | 8-181 | NKIEPTEEELDAFILKIEEKERQHQIKMDADRKKLIEELKSSSLSDREREQKASHLESIESNLKAMQEMNERTKGMEEEMRPMKREI… |
| A0A126V1G6 | 144-311 | ATVLGEELSTTDADELQKTIVSRLFDQYAAERGIEATTVEIDTFLKKMRQSEAEVGTSKRDTLTPEATAEIETMESGKAIGLIRQWK… |
| A0A534ZNE3 | 378-555 | None |
| A0A357G008 | 119-308 | None |
| A0A6P1DV31 | 13-192 | None |
| A0A7X6US04 | 2-150 | None |
| A0A506RHC9 | 56-223 | None |
| A0A1V6F6G2 | 31-206 | None |
| A0A518CM70 | 45-273 | None |
| A0A1V5N4F0 | 60-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.