DPCstruct | MC44095
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 110 ± 4 aa |
| Standard deviation of domain lengths | 4.25 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 42.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820ED81 | 1-114 | VYYGDDLALYYDDDVARSTVPYISKYLSDAWRYVKRNYGSFGPDERLYAIFHTGRYSGGHPSYYYSASHDFKNVIDQGAGPWFEQLG… |
| A0A2U0ZIJ2 | 67-173 | FYSKHLSVYFDKDVKTTITWPFTYLDSAWQYTKKTYGLFGKDPHLYAIFHAGRYSGGHPSTFFDESHDYRNVIDCGADDANAWVTGV… |
| A0A3Q8I3J0 | 44-158 | None |
| A0A833UIY3 | 1-107 | None |
| A0A5B9W958 | 410-513 | None |
| A0A815FTQ8 | 205-306 | None |
| A0A818VUA9 | 278-387 | None |
| A0A1D1W624 | 237-348 | None |
| A0A1D2MAF4 | 135-249 | None |
| A0A1D1VJP5 | 264-377 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.