DPCstruct | MC44093
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 221 ± 40 aa |
| Standard deviation of domain lengths | 39.84 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 19.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820E2U5 | 2-209 | KVTWDQNNNRTLIVIDLASTSSTKNVVDTPDFLATGVKMQVVPHQEHINFEHSLVFVCTTINRGNNEETLKRILRSLVIEDEFRKEI… |
| A0A819BTT8 | 358-562 | GICWITVIWNQNNHTSSFLVDSINTLSVNYTSEHIIMASADMTVVHQHEFLQVNHSFGYVCLSNKCNNEMSLKQILHSLVIEDKFAH… |
| A0A813PHR4 | 18-278 | None |
| A0A819V1V8 | 534-814 | None |
| A0A819WLQ5 | 32-269 | None |
| A0A814VUY1 | 20-236 | None |
| A0A822DIS9 | 5-185 | None |
| A0A813YKG7 | 2-239 | None |
| A0A813PNQ6 | 104-347 | None |
| A0A814MMW5 | 1-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.