DPCstruct | MC44090
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 201 ± 18 aa |
| Standard deviation of domain lengths | 17.69 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820CKE9 | 391-600 | NPLYYLINIYKETKGTSQLVNDLICLTTNKIQFNINEILRDGFEKPTRTSCIYAVLFEDYFKGSLLNQTIIDQLLALWNTWEDEGFR… |
| A0A817YTZ6 | 239-457 | SRENPLYHLIAMDKQCHSQSQLVSSLIQLAANKIQITIDEILRDTFERPVRTSCIYAVLFEDCFKNLTLRQIVIDQLLALWNAWEEE… |
| A0A815NQF2 | 2-170 | None |
| A0A814RXK3 | 320-539 | None |
| A0A820V990 | 111-331 | None |
| A0A820WAV7 | 214-391 | None |
| A0A816REU5 | 58-273 | None |
| A0A821HZQ6 | 6-214 | None |
| A0A815ZDE2 | 3-216 | None |
| A0A821A9J4 | 222-416 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.