DPCstruct | MC4409
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 139 ± 11 aa |
| Standard deviation of domain lengths | 10.83 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R6WWR5 | 198-337 | VVFDTIADRFFSLDFRHLQRVPTSHCWDGGESRLIVCETAQEHLEATSISGKNSGDLQLTVLFATSEDGLLELEQVDIGFKSRLLGM… |
| M7BY25 | 189-328 | DRIPVSHFWDHSEPRLFVCEAVLEPNLQFPDKKQQQTESSESTPDVLIISFFSTEEHGLLLQDSFPLPSTYQALLGIEVPHYYFAKK… |
| A0A176WBE2 | 135-277 | None |
| A0A1D1ULT8 | 439-558 | None |
| A0A1X7VEQ4 | 36-168 | None |
| A0A5N4C053 | 91-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.