DPCstruct | MC44083
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 204 ± 33 aa |
| Standard deviation of domain lengths | 32.62 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G5K428 | 4-157 | AVGCSHIRNRFISTFRRDILRDATSKDREIIGQGKLVADKGTLWADAKLYDREGFVTENGKQFSPRDDYHVLKQLYGVAPALAVIID… |
| A0A3N4IZL4 | 26-222 | GNRHGLGFTGLLERVHELEQRDVLKDRKITSLEDKANSLEDQLYTLKLSIQEYSHVRNAFISTFKRDKLNNATELDIDIIRKGNRIG… |
| A0A1L9V682 | 3-160 | None |
| A0A1L9VTR2 | 4-177 | None |
| A0A2V1D4B9 | 27-219 | None |
| A0A2T6ZDB6 | 556-800 | None |
| A0A2T6ZPA4 | 61-282 | None |
| A0A2T6ZPW9 | 2-179 | None |
| A0A2J6QDN1 | 232-447 | None |
| A0A395IIP7 | 178-411 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.