DPCstruct | MC44082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 485 ± 94 aa |
| Standard deviation of domain lengths | 94.18 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N4IXJ9 | 28-539 | STSTTTYDIDSFIAKVKCLSVAKKGLRVQFSPSCLRNISTDVHLYSKIEERLLSGNIKICQVPLHHIPHFYLGHLASSLHLPLYVFL… |
| A0A4S8KJZ8 | 43-513 | FLLTGEALGEHHQANINVIPNLLPPNAGITTFRDYDSFIGIDEDLLVQGPLSIYPNPNPQYTLSSSVHIQIPFDEGRAVHLHRIPNF… |
| A0A3N4IXA4 | 11-496 | None |
| A0A6A4GL36 | 12-518 | None |
| A0A6S6W5G3 | 286-829 | None |
| A0A6S6VZ61 | 24-525 | None |
| A0A0J9VY67 | 7-489 | None |
| A0A0C2YJK3 | 8-733 | None |
| A0A366S461 | 45-590 | None |
| A0A2T6ZA87 | 350-935 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.