DPCstruct | MC44080
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 115 ± 18 aa |
| Standard deviation of domain lengths | 18.49 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M2E1X5 | 2-109 | FALVRFLSDHDGKVHRVPATNIKEFEPADDTDFDPKFVYAVFWHEQENSGHYPAQILMMAETEEKLNYKQQNKRVRIAKIPVSEYEI… |
| A0A232FFS6 | 1-114 | MELYACIRFVEENLYSAKYYYIPITSVYCNKHDTDHIVPVDLGDYDTKNKYYIFWNDGVNEDKYLGYIVSLGESKEDAKNRTLTREK… |
| A7STH7 | 4-159 | None |
| A0A7M7Q2C4 | 42-167 | None |
| A0A6J1RD60 | 5-142 | None |
| A0A6P7UFU2 | 1-107 | None |
| L7M1I6 | 8-101 | None |
| A0A6P7V9A7 | 1-106 | None |
| A0A6G5AH93 | 1-101 | None |
| A0A6P7VWI8 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.