DPCstruct | MC4408
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 98 ± 16 aa |
| Standard deviation of domain lengths | 16.05 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183V2R9 | 31-114 | DRSNPATHQPPEPGHEKLYTYRSICMSDEGKMRILHGFDCRYQVAVGRFRNAVNDSGWSFLEIETKPEYPPEIQAYAAGVLEER |
| A0A3P7KZ19 | 2-89 | LAAYLATLFLITKLATATTEGKDERYTYNQMCVVEGKLTVLNGFDCREQVAVAKWRNSVNASGWTFLEVETYSKFNPELQAYAAGYLE |
| A0A0H5S6M2 | 35-119 | None |
| A0A2H2IWR4 | 22-156 | None |
| A0A0D8XQZ6 | 1-107 | None |
| A0A0M3HIL5 | 13-100 | None |
| A0A7I8X0K9 | 699-804 | None |
| A0A0C2C7Z6 | 5-106 | None |
| A0A7I8WK47 | 36-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.