DPCstruct | MC44070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 226 ± 64 aa |
| Standard deviation of domain lengths | 64.10 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 89.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02514 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N9IED0 | 23-212 | PPGNLNSDGENLLPTSWLCSISLLEKIFTLFFMALMSLEFMPGKQVGMSDVCYPDSLIGNIPNIYYYAANNPSEATIAKRRSYANTI… |
| A0A1V3X3T8 | 45-204 | VVHLGKHGNLEWLPGKTLGMSAACGSDAALGNLPLIYPFLVNDPGEGTQAKRRAHAVLVDHLIPPMARAETYGDIARLEQLLDEHAA… |
| A0A396QH24 | 73-337 | None |
| A0A1E3H0K6 | 83-339 | None |
| A0A0Q3NW02 | 349-670 | None |
| A0A7G9ZA00 | 2-253 | None |
| A0A1U7PZB8 | 132-427 | None |
| A0A7W7A4Z3 | 260-501 | None |
| A0A7S1TGH0 | 39-293 | None |
| A0A177E737 | 113-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.