DPCstruct | MC44069
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 312 ± 54 aa |
| Standard deviation of domain lengths | 54.32 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.48 |
| Pfam Score | 85.44 |
| Assigned Pfam label(s) | PF09169- PF09121- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N9I3U7 | 243-575 | APELSYMFYQDHLLYHLIIHVAKEEFPHDTRFRFREYMKEKSIMPLRSAIKGILEGDASPSAMMVLCISAICSNCDLENETCSVAVI… |
| A0A1Y1S8C3 | 171-394 | KMMELYETCRQIFSKKPLGWIREQFKWIWLHFVLNPIDYAMLRDEMIRMMNFRVKNEQSFFRGVLETSIPPFKYCVLGILGIKKETV… |
| A0A453E453 | 1-268 | None |
| W5MNL3 | 92-495 | None |
| A0A397JED6 | 267-563 | None |
| A0A197JNE7 | 14-346 | None |
| A0A0H2RWS6 | 124-528 | None |
| A0A0V0J7G0 | 695-982 | None |
| A0A183J650 | 389-660 | None |
| A0A194PSK5 | 1-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.