DPCstruct | MC44061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 349 ± 65 aa |
| Standard deviation of domain lengths | 64.86 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 21.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0044 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z0PTP9 | 9-380 | AQGTKIQTIDDLHQYLYKGLQLEHATLPPYLTALYSLHPGKNADAWHVIRVVAVEEMLHLTLVANVLNAVGGTPELTKQGFVPNYPA… |
| A0A3S3QDM3 | 15-453 | TPENLGEALQQAIEIEISTIPTYLFTYYSIVRSPSQQNMINSLTNALLKIDKEPRYTFDEASEIALNFSADIMVFANRTGALIMSVA… |
| A0A6G4VIL5 | 18-254 | None |
| A0A1I0D5K3 | 6-313 | None |
| A0A7K2XUJ9 | 315-667 | None |
| A0A5C7XNL8 | 485-838 | None |
| V9Y0K9 | 666-1070 | None |
| A0A1Q9SQP5 | 33-349 | None |
| A0A2G6XYD4 | 296-583 | None |
| A0A433DK33 | 15-483 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.