DPCstruct | MC4406
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 360 ± 58 aa |
| Standard deviation of domain lengths | 58.19 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03134 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E7ER00 | 15-350 | KWTHGPWVPHVGFWGISMLFKIIFPSYSKWLAYDNITTFLLCVFYPLCSTVSLIHRNRQHQETTISDDKVETELQIERQYWIEYWSV… |
| A0A183UYW1 | 44-336 | NSVFAKFEESTGAKREHLAYAVVGIIAFYLIIGQCAELLCNLIGFAYPAYASVKAIRTPEKDDDMQWLTYWTVFAFFSLLDFFAHAI… |
| A0A0V0WT45 | 5-295 | None |
| A9UYQ8 | 32-457 | None |
| A0A7S4DRJ1 | 30-339 | None |
| R1DMQ1 | 12-318 | None |
| M4BDE5 | 1-368 | None |
| A0A2V3ITW0 | 17-526 | None |
| A0A5B8MIR7 | 84-424 | None |
| A0A7S4BYI9 | 91-443 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.