DPCstruct | MC44053
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 81 ± 11 aa |
| Standard deviation of domain lengths | 10.66 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01259 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A357NN27 | 6-80 | TLLQSDLPGLPLRHRGKVRDVFDIPRDRLPAGTPPGDYLLMVATDRLSAFDVVLPDPIPGKGEMLCQVSNFWFAK |
| W7Z2S1 | 1-70 | MTATAISTAVELVDAPLLYKGKVRELYDLGEHVLIVVTDRISAFDYVLDPAVPEKGNVLNRLSAFWFEQT |
| A0A1F6LHR9 | 424-499 | None |
| A0A453L0F5 | 105-200 | None |
| A0A200QXR0 | 129-215 | None |
| A0A7R9N016 | 1-65 | None |
| A0A2J7ZN10 | 77-161 | None |
| D0NC79 | 1-98 | None |
| A0A0G1IHF6 | 4-76 | None |
| A0A6L7RV74 | 1-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.