DPCstruct | MC44052
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 97 ± 8 aa |
| Standard deviation of domain lengths | 7.72 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10120 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843DR63 | 1-83 | GCIRLNEDIAETVRELLQDVEEYDAEKFPKGISTMEWGIAFLCKEGVPAAVVAQNEPTYGGCIYIFGETPEDVANRILIISER |
| A0A7J2LAT0 | 58-162 | ASKHTASVLLIARKVNEKNRACICVKYDDKVNEALMKLNFKVVWIDREKFEDADIVDILEKILDEIPHEFDAIIDPGWIGIEPIAYI… |
| A0A2R7Y1H9 | 2-86 | None |
| A0A7J2ZCK4 | 78-179 | None |
| A4WJD3 | 37-123 | None |
| A0A7V4K374 | 130-226 | None |
| A0A2J6N838 | 216-317 | None |
| A0A2P6VXS4 | 234-332 | None |
| A0A497N733 | 210-317 | None |
| U1NB64 | 208-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.