DPCstruct | MC44051
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2124 |
|---|---|
| Mean domain length (aa) | 172 ± 30 aa |
| Standard deviation of domain lengths | 30.10 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 12.61 |
| Pfam Score | 80.11 |
| Assigned Pfam label(s) | CL0020- CL0414- PF09743- CL0388- PF14214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843DQR7 | 12-156 | QNNQRVSALPNLITAYLQENPGAQLYKIVEAVSASRGAVTYQLRTMTAKGVIKVHEETGCRRYYLHSFEYAKDTAVLQIFLENETKS… |
| A0A645HGX1 | 2-114 | KEEIIKEFKNLKFSPPKYTDMVAKQKDKAGFKMVYDSLIDQSIIIRLNEECTLLNEDYNSGKELIKKYIIENGSIAAGSARELLNTN… |
| A0A814TIN3 | 63-216 | None |
| A0A523DNN0 | 94-271 | None |
| A0A0K0E141 | 41-238 | None |
| A0A1C2I688 | 2-164 | None |
| A0A5D4JLF6 | 298-434 | None |
| A0A1C4JF95 | 498-648 | None |
| K9Q5M0 | 101-284 | None |
| L0DQD3 | 177-363 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.