DPCstruct | MC44047
Metacluster Properties and Pfam Annotations
| Number of structural domains | 457 |
|---|---|
| Mean domain length (aa) | 180 ± 41 aa |
| Standard deviation of domain lengths | 41.12 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 86.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.36 |
| Pfam Score | 68.80 |
| Assigned Pfam label(s) | CL0606- PF10106- PF06890- PF18946- PF12059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q4KYF8 | 9-183 | GLALATVVDAVDPDGRGWVKVSFFGEGGIESDWIPLASSYAGNGYGSFFLPMTGDLAVVGFISANADQPCVLGFLWNGGIAPPVAKD… |
| A0A7Y1F7Y9 | 1-129 | GKNWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYDLPENATQSGMKSRSSKGGTPANFNEIRMEDKKGSEQVYIHAER… |
| A0A250KYS3 | 118-325 | None |
| A0A1J0GGT6 | 100-312 | None |
| A0A662Q467 | 4-148 | None |
| A0A0P9PWA0 | 24-217 | None |
| A0A2W5KC78 | 67-216 | None |
| A0A0F7FCI3 | 273-451 | None |
| A0A250KUZ9 | 370-579 | None |
| A0A7W0QEQ5 | 20-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.