DPCstruct | MC4404
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 69 ± 5 aa |
| Standard deviation of domain lengths | 5.46 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X1A6T3 | 1-77 | MPQIGEIKLGKEIGRYSKNKFMWAACPDCGLERWVRLCGVKLINKRCCSCSNKYKAVRGENHPSWKGGRKRDGYGYI |
| A0A6I1Z6L0 | 61-126 | KPKIGEIKRAVEIGRDKKPYQKYILHACVICGKIRWVQLAKGKPKHLKCQSCAHWKGGKFKGSKGY |
| A0A0F9T660 | 2-65 | None |
| A0A0F9VK23 | 58-132 | None |
| A0A2D6FKC3 | 1-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.