DPCstruct | MC44037
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 113 ± 24 aa |
| Standard deviation of domain lengths | 23.53 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 67.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3DJX9 | 5-131 | ETSKKNKAKNTDQRDNRNSNNNNNKVVEVKAQGKQEQAEAKNKRKRKDFFPFGNYRNYYGYRIGNDLEEDPRLRVLKKEWFQDKDCL… |
| A0A6A1UJB1 | 19-88 | EKEMKQPRKRKRKEIGQDLKEDPRLKVLKKEWFEDKDCLDIGCNSGIMTILIAKNFHCRSILGIDIDSNR |
| A0A0L0SFJ5 | 1-83 | None |
| J3MUV9 | 3-147 | None |
| S9XTQ0 | 204-313 | None |
| A0A5N4EBC9 | 26-128 | None |
| A0A670ZNY7 | 270-402 | None |
| A0A0L8G7E8 | 331-437 | None |
| A0A0D2LY18 | 118-233 | None |
| Q23GA7 | 27-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.