DPCstruct | MC44035
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 105 ± 13 aa |
| Standard deviation of domain lengths | 13.37 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A415ZYP0 | 6-120 | GVRDNSRIRKLTPRECFRFMGFDDEAIDKLLAAKFSNTRLYKMAGNSIVVDVLKRLFAQIFVSNPEIFPEEKEIKYLSLFSGIGAFE… |
| A0A452XCB2 | 63-161 | DKAAPLEPHEMEYLLGFPKDHTRGFGKTQRYKSLGNSFQVDTVAYHLSVLRDMFPNGITVLSLFTSIGGGEVALHKLGIHMRAVVSI… |
| D4KCC8 | 51-165 | None |
| A0A1U8FHL2 | 600-698 | None |
| M4CJK4 | 386-484 | None |
| A0A2P6RWF8 | 31-130 | None |
| A0A316NA61 | 287-401 | None |
| A0A1S3ZNN7 | 841-939 | None |
| A0A4S8JLE9 | 503-602 | None |
| A0A565CV26 | 501-578 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.