DPCstruct | MC44028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 75 ± 8 aa |
| Standard deviation of domain lengths | 8.07 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 94.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 44.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02698 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B3FCE4 | 1-70 | MCASERLEFDDYLKSIGDEKLVLDMLAGDLQRVIEYPKLGFAIEQEVPEDVHAAYESLIRSGFTSRLIAS |
| A0A1H0FEW2 | 26-105 | ATCRKVWPEVEVICSSRPLPLDEYIATIGDVDRVITMLVGDTQRITQYARLGFAIEQDVPEPVHAAYQRLVDAGFTSRLI |
| A0A7W1W6H3 | 1-58 | None |
| A0A1Q7N508 | 117-200 | None |
| A0A6I1ZQ66 | 50-129 | None |
| A0A1E9H670 | 130-215 | None |
| A0A0G0P5Q8 | 19-88 | None |
| A0A4Q7USN7 | 47-127 | None |
| V6JT22 | 92-171 | None |
| A0A814UD30 | 414-481 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.