DPCstruct | MC44024
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 213 ± 27 aa |
| Standard deviation of domain lengths | 26.83 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 23.23 |
| Pfam Score | 98.65 |
| Assigned Pfam label(s) | PF19160- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444X3F1 | 9-223 | FGFAVFLGMHFPPLMADCPLDFSASNFTLASSLCSNQGDRGNCCRYINANVAISVARFANSTSILGVPPNDSVSCLQTISDKLQLNG… |
| A0A072VGE1 | 6-204 | MFLLLLFTLSIATPSASSISCPMDLSYVETFPWDTSSCRDPIDTQHCCQTLLSLFGIGLAKHLKETSLFQLPNKNTLKSCLQDFKLK… |
| A0A1E5UVL6 | 19-200 | None |
| A0A835RR05 | 13-257 | None |
| A0A287IGX0 | 7-190 | None |
| A0A4D9BK61 | 8-271 | None |
| A0A446MD58 | 7-233 | None |
| A0A446MA38 | 60-271 | None |
| A0A2N9I6Y3 | 25-240 | None |
| A0A1U8FRZ0 | 9-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.