DPCstruct | MC44022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 77 ± 4 aa |
| Standard deviation of domain lengths | 4.23 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 59.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5P1EFC5 | 188-256 | TRACLISKQARLENRVRCPYCGARVWSMRGARMVPKSASRRLGCPEEGLEYFVCVNGHLHGICCVNAEL |
| A0A1D6IIU8 | 1-74 | MLIEKRARFHPRELCSYCKSKLWNMFQENMIPRSASARLGAYDDSVEYFVCLNGHVIGLGTLLPLSDSEEAADE |
| A0A427B5U5 | 394-469 | None |
| A0A0E0QAS9 | 171-247 | None |
| A0A7J8MB86 | 27-99 | None |
| A0A3L6RD46 | 116-196 | None |
| A0A6J5UHM8 | 267-350 | None |
| A0A392P8J1 | 102-180 | None |
| A0A5N5HQA9 | 540-614 | None |
| A0A7J8LQI2 | 75-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.