DPCstruct | MC44021
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 79 ± 12 aa |
| Standard deviation of domain lengths | 12.17 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 52.71 |
| Pfam Score | 98.53 |
| Assigned Pfam label(s) | CL0016- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444WZ46 | 109-175 | QEGSYPGGVHLEMTGQNVTECVGGSRTITYDDLSSRYHTHCDPRLNASQSLELAFNIAERLRKKRMQ |
| X8F731 | 72-137 | RHFDRIVDEVQGFFEVHRGLGTHPGGIHVEITGENVTECLGGAQDISDSDLSGRYETACDPRLNTQ |
| R9NVV2 | 427-539 | None |
| A0A2I0HTI0 | 22-106 | None |
| A0A655JG07 | 112-183 | None |
| A0A655F824 | 282-353 | None |
| A0A6A2XM19 | 325-401 | None |
| L8HFZ7 | 335-429 | None |
| A0A1V5J5Y8 | 51-125 | None |
| A0A6A6LCL5 | 1139-1223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.