DPCstruct | MC4402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 437 |
|---|---|
| Mean domain length (aa) | 183 ± 37 aa |
| Standard deviation of domain lengths | 36.99 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.36 |
| Pfam Score | 98.77 |
| Assigned Pfam label(s) | CL0028- CL0531- CL0529- PF03595 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D0LZT2 | 2-125 | TPTIDLLQSHRSIRHFTDEPITEAQRAAIIDSARATSSSSFLQCSSIIRITDPAMREQLVTLTGGQKHVAQAAEFWVFCADFNRHLQ… |
| X0ZXM7 | 52-236 | IDLPEPKIKGEMSLEEAIKDRRSIRSFDEKDLNLEQISQLLWAAQGITDERGHRASPSAGALYPLELYIVKKDGAYHYIPEGHKLEM… |
| A0A830Z0Q1 | 4-195 | None |
| A0A371PEA5 | 240-446 | None |
| F3NJY9 | 489-716 | None |
| A0A2H3TQX0 | 174-366 | None |
| R7WR52 | 99-312 | None |
| A0A7D8A6E4 | 2-180 | None |
| A0A448Z174 | 33-276 | None |
| A0A365ZSY8 | 1-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.