DPCstruct | MC44017
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 273 ± 29 aa |
| Standard deviation of domain lengths | 28.67 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0362 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A350KLZ5 | 58-300 | NRFRIEKQISDSVTGTPYIPGSSLKGAIRTALMSVKADKLDVRKNDFKKSADAEKMLYGYANPTDDPFKALKLGDAVAKNPLMTNIC… |
| A0A839H7R2 | 3-274 | RPILPGSSLKGAIRTALLDQVNGDASLQQVPDRRTGGMRRENNQELQQRLFDYRAGQFHLDPMRLVQLGDAADVRSADTLGTEIRYA… |
| A0A3M1QMX0 | 107-378 | None |
| U1GYA2 | 113-390 | None |
| A0A496RFS4 | 110-358 | None |
| A0A654RLX4 | 19-314 | None |
| A0A6P0TPZ2 | 1-318 | None |
| A0A2M7I366 | 109-414 | None |
| A0A1V6E9F9 | 96-384 | None |
| C3NJE2 | 89-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.