DPCstruct | MC44014
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 61 ± 3 aa |
| Standard deviation of domain lengths | 2.91 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.96 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 49.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11450 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W4X7R4 | 1-61 | MPAKSKAQQKAAGAALAAKRGAAKPSALKGASKQMYKSMSEKQLDDFASTKRKGKPDYVED |
| A0A2D7LK73 | 1-58 | MPSVSKQQQKFFGVVKAMQKGDTPKKGKAGKAAKSMSKDDVDDFASTKHKGLPKKVKK |
| A0A550KMZ1 | 28-84 | None |
| A0A3M1AH85 | 1-58 | None |
| A0A2D6WVV4 | 1-62 | None |
| A0A497PQZ8 | 1-67 | None |
| A0A1A9FSU3 | 1-65 | None |
| A0A1M7DNZ3 | 92-153 | None |
| A0A2M9U6B4 | 1-58 | None |
| A0A2W4V1K5 | 154-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.