DPCstruct | MC44013
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 248 ± 41 aa |
| Standard deviation of domain lengths | 40.77 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 20.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04205 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A417WY47 | 50-322 | RGIQNAVKQALENAKKATNGETVPDNGTSSGGTTTIPEGKFPYEEGIYYGTGEGYLGDITTAVVIQDETIKAILVTESEDDEAFLKR… |
| A0A845RTI1 | 47-354 | QQAEKAEAHLLKTQDPAAISYKDSEGHTDDIAGVSVHVDAFFELAAKALAAGPVGRGPYADGAYFAIDEAYPSSGWKEYVSLTVLNG… |
| A0A089M2X6 | 205-413 | None |
| A0A2V2FYQ9 | 47-200 | None |
| A0A7C6YQ09 | 9-207 | None |
| A0A424Y437 | 17-233 | None |
| A0A2E2SSD2 | 1-294 | None |
| R7EB96 | 245-455 | None |
| A0A845QWI5 | 28-309 | None |
| A0A413PX13 | 60-338 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.