DPCstruct | MC4401
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 142 ± 14 aa |
| Standard deviation of domain lengths | 13.69 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G3HI50 | 165-288 | LAASIVNGGRLYDDWQLQSGGPGQALPHPAYPPKAYYANSPGMTWRCKECHGWDYKGNQGEYASGTHATGIKGIRAMAGADPEKIMD… |
| A0A3M1E6T7 | 256-393 | TGPTATVPGAYLLADPVRGGLLYDRWWAVNGATPPTGDHPLYPAAGLQSGSATFRCKECHGWDYAGVDGAYGSGPHFTGIGGVLDTT… |
| A0A7Y5RW77 | 590-711 | None |
| A0A2U1VCL4 | 220-347 | None |
| M1FEW0 | 1-164 | None |
| A0A2M7TU96 | 1-152 | None |
| A0A1G3IDW4 | 7-140 | None |
| A0A6J4FE62 | 308-441 | None |
| A0A0S7BEZ7 | 1-160 | None |
| A0A0S8AN48 | 4-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.