DPCstruct | MC44006
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 237 ± 32 aa |
| Standard deviation of domain lengths | 32.49 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 27.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0XYA8 | 23-225 | FAYKWQEVLSSKPWTRYSQSFVSFLPPTSNARKHFNVRLQRFFAAHGRALWERYFWIGTYTCEEHVGPCRRLVAARAALGLLMFELY… |
| A0A6A4Z1V5 | 84-306 | RDVDATYMAVASSKPWEQYKAQESFIHSSWRRLPLWAELQEQLEDFWENHALAHWNRRFMRGSAEVNAEVEAAMGPLVGIIGCLYRI… |
| A0A329RZT7 | 475-687 | None |
| A0A024UCQ2 | 517-749 | None |
| A0A397D2R2 | 213-491 | None |
| M4BG02 | 543-753 | None |
| A0A418B2Z6 | 267-556 | None |
| A0A418AX97 | 354-636 | None |
| V9DSK0 | 1-224 | None |
| A0A0P1AXD3 | 1037-1253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.