DPCstruct | MC44004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 99 |
|---|---|
| Mean domain length (aa) | 176 ± 26 aa |
| Standard deviation of domain lengths | 26.09 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.01 |
| Pfam Score | 98.55 |
| Assigned Pfam label(s) | PF03798- PF03208- PF04749 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0XRR2 | 12-203 | KSPLDRIHLLRLQVRDLMNLNNIRGFFSFFGFGEDQPFLLPRDRCEFECRTKSNMAYFSVNYFVITCLVGFQHALVNPVFMVVLTVV… |
| A0A2P6NFB9 | 9-154 | FELRPWGSFGDHKEFVPPKDAQEARSKGEANLRYYKANYAVVALAIYGLTAWFSTYFTIVVLLTGAVGGVLFFLKDLVVGGHKVNET… |
| A0A813M7N2 | 13-181 | None |
| A0A7R9AM02 | 196-338 | None |
| A0A5J4YSS7 | 95-283 | None |
| A0A817PUQ2 | 75-296 | None |
| A0A7J9K5H2 | 2-142 | None |
| A0A6P5FFJ8 | 79-240 | None |
| M3ZJ33 | 3-158 | None |
| A0A6A6LCW5 | 5-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.