DPCstruct | MC44002
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 408 ± 48 aa |
| Standard deviation of domain lengths | 48.08 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 35.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0XLI2 | 45-414 | TQTAKLEARRLSVNATVGLPVTPTLFEFPGDKYESEVVEMIPRRVLNASLSCEDELTVLEKNVNVETVLGQPEAFRRDNKVLLMLNG… |
| A0A2P4Y5Q8 | 1-417 | MHVELVLGQEHHLRDQGRVFFMLNGQNEGIYLSWMHKESCLLELAQTAALHLAADSERVANGLKLFSIDGLPILTADELNTLRIAHV… |
| A0A024GDB3 | 25-422 | None |
| A0A397CDW8 | 2-365 | None |
| A0A1W0A697 | 292-630 | None |
| W4GMH6 | 47-541 | None |
| A0A225X1S1 | 282-649 | None |
| A0A024TVE8 | 51-535 | None |
| A0A418D1S9 | 222-654 | None |
| A0A3R7H1H4 | 23-491 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.