DPCstruct | MC44001
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 147 ± 29 aa |
| Standard deviation of domain lengths | 28.80 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10258 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P2B7U9 | 1-127 | MQIRKVASEVANTLGEKDRKPYGQIAALVRMRGEDFIREVLADTLQIEAQGGMMTAKGDRRRTIGGVFFRLARERLTRNEGLLIFAR… |
| A0A6G0XJI7 | 15-146 | KKQNHAYRVGREMAHVLGERKIHLVVRVVSLIGERLARSVLSETLAMHKEGKTLKTVTGRPRTLGGAFFTLLKERVTKEKYKEIYAL… |
| M4BQV5 | 2-163 | None |
| A0A1J4MH86 | 13-137 | None |
| A0A3P6HNG9 | 31-165 | None |
| A0A0N5D2X8 | 114-291 | None |
| A0A0G4HBC8 | 35-184 | None |
| A0A0R3S2D0 | 292-488 | None |
| A0A7S2V4D6 | 68-217 | None |
| D7FHZ0 | 182-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.