DPCstruct | MC4400
Metacluster Properties and Pfam Annotations
| Number of structural domains | 124 |
|---|---|
| Mean domain length (aa) | 292 ± 68 aa |
| Standard deviation of domain lengths | 67.85 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 87.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02624 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A165UPA9 | 29-308 | GKSIISHTHLPSFRHDIYYNENVKLDWIKGTDINQATEVYAPASAIFFNQQPAFHIPTTNGLASGNHIIEASIHAVYELLERDAGSR… |
| A0A4U9HRJ6 | 12-220 | GMSAGNTRNEARVQGLSEVFERHIKNRIIAESISLPEIPADVLARYPGVVESIAKLEAEGFPIFAYDGSLGGKYPVICVVLFNPANG… |
| A0A3S1AL43 | 307-499 | None |
| A0A7V9HEQ3 | 31-390 | None |
| A0A0E4BGK4 | 30-319 | None |
| A0A1S2QAR2 | 325-684 | None |
| A0A831R8U5 | 41-330 | None |
| H4F9J5 | 11-310 | None |
| A0A0W1QI54 | 2-163 | None |
| A0A3E2YNH5 | 497-871 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.